TABLE 1

Sequence alignment around the candidate peptide of UGT1A9 as an antigen with the other UGT1As

Multiple sequence alignment was performed using the ClustalW2 program (http://www.ebi.ac.uk/Tools/msa/clustalw2/) for amino acid residues 61 to 142 of UGT1A9, which were used as an antigen by Girard et al. (2004). Amino acids that are identical with those of UGT1A9 are in bold type. The peptide comprising amino acid residues 87 to 118 that was used as antigen in this study is in italic type.

IsoformAccession No.SequenceIdentity with UGT1A9 (%)
87–11861–142Full-Length
UGT1A1P2230963DASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFE--NDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSF145122466
UGT1A3P3550364EVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFE--TEHFLKKFFRSMAMLNNMSLVYHRSCVELLHNEALIRHLNATSF14692067
UGT1A4P2231064EVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFE--TEHLLKRYSRSMAIMNNVSLALHRCCVELLHNEALIRHLNATSF14691767
UGT1A5P3550464EVNMYIKEENFFTLTTYAISWTQDEFDRLLLGHTQSFFE--TEHLLMKFSRRMAIMNNMSLIIHRSCVELLHNEALIRHLHATSF14661867
UGT1A6P1922462EVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHF--AERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKF144122968
UGT1A7NP_06195061EVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNG---IFDLFFSNCRSLFNDRKLVEYLKESCF142598093
UGT1A8AAB842561EVSWQLGKSLNCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNG---FFNLFFSHCRSLFNDRRLVEYLKESSF142638094
UGT1A9NP_06630761EVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYND---IFDLFFSNCRSLFKDKKLVEYLKESSF142
UGT1A10AAB8153761EVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSG---FLDLFFSHCRSLFNDRKLVEYLKESSF142638088