TABLE 1

Peptide mapping of HSA by trypsin digestion combined with LC/MS

1 * 10 * 20 * 30 * 40 * 50
1DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA
51KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE
101CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY
151APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGK*ASSAKQRLKC
201ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL
251LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA
301DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA
351KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE
401YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE
451DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK
501EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD
551FAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL
  • Underlined, identified by LC/MS on tryptic digested radioactive band of SDS-PAGE; bold, the tryptic peptide (residue 182–195) bound to HKI-272; *, Lys190, the residue bound to HKI-272.