TABLE 3

Sequence alignment of the antigen peptide of human UGT1A10 with highly similar rodent Ugt1a isoforms

IsoformAccession No.SequenceIdentity with UGT1A10 (%)
84–115Full-length
Human UGT1A10AAB8153784EDQNREFMVFAHAQWKAQAQSIFSLLMSSSSG115
Mouse Ugt1a7cAAP4859884EDLNREFKISIDAQWKSQQEGGILPLLDSPAK1154075
Mouse Ugt1a9AAP4859982EDLDREFKYLSYTQWKTPEHSIRSFLTGSARG1134378
Mouse Ugt1a10AAP4860084EDLDREFKYFTYTQWKTPEQSIRSFMTGSARG1154676
Rat Ugt1a7AAR9563584EDLNREFKFFIDSQWKTQQEGGVLPLLTSPAQ1154075
Rat Ugt1a8AAR9563684EDLNYHFKFFAHNQWKTQEVGMFSLLKHSGKG1155375
Rat Ugt1a10AAR9563084EDMDREFKHFSYTQWKTPEQSMYSLITGSVKD1154373
  • Multiple sequence alignment was performed with the Clustal W2 program (http://www.ebi.ac.uk/Tools/msa/clustalw2/) for amino acid residues 84–115 of UGT1A10 and those of the corresponding region of rodent Ugt1a isoforms. Amino acids that are identical to those of UGT1A10 are typed in bold letters.