TABLE 2

Sequence alignment of the antigen peptide of human UGT1A10 with the other UGT1As

IsoformAccession No.SequenceIdentity with UGT1A10 (%)
84–115Full-length
UGT1A10AAB8153784—EDQNREFMVFAHAQWKAQAQSIFSLLMSSSSG-115
UGT1A1P2230984-QREDVKESFVSLGHNVFEN–DSFLQRVIKTYKK-1151265
UGT1A3P3550384WTQDEFDRHVLGHTQLYFET–EHFLKKFFRSMA–1151266
UGT1A4P2231084WTQKEFDRVTLGYTQGFFET–EHLLKRYSRSMA–115665
UGT1A5P3550484WTQDEFDRLLLGHTQSFFET–EHLLMKFSRRMA–115666
UGT1A6P1922484–QEELKNRYQSFGNNHFAE–RSFLTAPQTEYRNN115667
UGT1A7NP_06195084EDQDREFMVFADARWTAPLRSAFSLLTSSSNG-1156893
UGT1A8AAB842584EDLDREFMDFADAQWKAQVRSLFSLFLSSSNG-1156894
UGT1A9NP_06630784—EDLDREFKAFAHAQWKAQVRSIYSLLMGSYND-1156593
  • Multiple sequence alignment was performed with the Clustal W2 program (http://www.ebi.ac.uk/Tools/msa/clustalw2/) for amino acid residues 84–115 of UGT1A10, which were used as an antigen in this study. Amino acids that are identical to those of UGT1A10 are typed in bold letters.